PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g063290.1
Common NameMTR_7g063290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 488aa    MW: 54862 Da    PI: 6.9693
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g063290.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-10107147445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll+++ +++G+++W+ +a+++g ++  + c ++++
  Medtr7g063290.1 107 WNADEEILLLEGLEMYGMNNWAEVAEHVG-TKNKEACTEHYR 147
                      *****************************.**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002912.2E-114387IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013511.3644390IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.0E-1444110No hitNo description
PfamPF005694.3E-104486IPR000433Zinc finger, ZZ-type
CDDcd023359.15E-254795No hitNo description
PROSITE patternPS0135704976IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.17E-11100152IPR009057Homeodomain-like
PROSITE profilePS5129318.92102154IPR017884SANT domain
SMARTSM007171.1E-9103152IPR001005SANT/Myb domain
PfamPF002491.4E-9106147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-7107147IPR009057Homeodomain-like
CDDcd001671.27E-4122147No hitNo description
PROSITE profilePS509348.77401487IPR007526SWIRM domain
SuperFamilySSF466891.2E-15404484IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MEVYPKKKAS IEALKELSRK NKNAASGNNS ESGAAGQGAG EAKRHLYHCN YCNFDITGKI  60
RIKCVVCSDF DLCVECFSVG AELTPHKSNH AYRVMDNLSF PLICPDWNAD EEILLLEGLE  120
MYGMNNWAEV AEHVGTKNKE ACTEHYRIVY LDSPCFPLPD MSHVVGKSRE ELLAMGKEQA  180
DNKKGSDSGL SVKAHAAART NQKASSRGRE KDSSRNSGGN KPKSSRNDSP SLVEASGYNP  240
KRQEFDIEYD NDAEKLLADM EFNDSDTADE IEIKLRMIRI YNRRLDERER RKKFILERNL  300
LYPNPFEKDL TPEEKAICRQ YDVFMHFHTK EAHEELLTTV ISEHRLKKKI QELKEARAAG  360
KRRRTEAEES ALRARESAYV VPRNRGVPNA LMSPDSADPR PAGRATSSSV NEMDATGANL  420
LSEAEKRLCC ELGLPPTVYL KMQEDLSIQM IAGNVSSKSD AHRMFQMDTM KVDMVYDMLI  480
KKGFGSP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1346363KKKIQELKEARAAGKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448949.10.0transcriptional adapter ADA2a
SwissprotQ9ATB40.0TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A072U0P50.0A0A072U0P5_MEDTR; Transcriptional adapter ADA2a
STRINGGLYMA15G12400.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]